PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G011100.1.p
Common NameSb04g001110, SORBIDRAFT_04g001110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 300aa    MW: 32133.6 Da    PI: 8.3495
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G011100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13e-161562148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g W++eEd++l d++ ++G g+W++++++ g+ R +k+c++rw +yl
  Sobic.004G011100.1.p 15 KGLWSPEEDQRLRDYILKHGLGCWSAVPAKAGLQRNGKSCRLRWINYL 62
                          678*******************************************97 PP

2Myb_DNA-binding50.83.8e-1668113148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg +++eE++  +++ ++lG++ W+ Ia +++ gRt++++k++w++yl
  Sobic.004G011100.1.p  68 RGMFSQEEEDVVINLQAKLGNK-WSQIAMHLP-GRTDNEVKNYWNSYL 113
                           788*******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.461062IPR017930Myb domain
SuperFamilySSF466896.6E-2912109IPR009057Homeodomain-like
SMARTSM007171.6E-111464IPR001005SANT/Myb domain
PfamPF002492.3E-141562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.9E-221669IPR009057Homeodomain-like
CDDcd001671.04E-101862No hitNo description
PROSITE profilePS5129425.29563117IPR017930Myb domain
SMARTSM007171.7E-1467115IPR001005SANT/Myb domain
PfamPF002492.5E-1468113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-2570117IPR009057Homeodomain-like
CDDcd001674.20E-1271113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MGCRSCEKPK MNYRKGLWSP EEDQRLRDYI LKHGLGCWSA VPAKAGLQRN GKSCRLRWIN  60
YLRPGLKRGM FSQEEEDVVI NLQAKLGNKW SQIAMHLPGR TDNEVKNYWN SYLKKRVMQA  120
QGASSNSSPK SPPELTSMST TELSSMSMHQ HHHVKNSSGG GGGGGSTTTS HDHDGNISGS  180
HALSAPAAAP LAQQPFDHQA RSFVFSDWAP AAPESYSVST HWPTSTASSG NVTPSHGHGG  240
GAFGDQMSGT YGAGALPTHQ DHHQSAAATA GIAGSGYFDL LNMGDIYGGF SSTNDDLLF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-25911723128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3686641e-153AK368664.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2077L03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002453174.10.0hypothetical protein SORBIDRAFT_04g001110
TrEMBLC5XSA10.0C5XSA1_SORBI; Putative uncharacterized protein Sb04g001110
STRINGSb04g001110.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122962735
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.15e-55myb domain protein 19